Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      HWRWLQFTVALPNFFFLLYYWCIPESPRWLISQNKNAEAMRIIKHIAKKN GKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIRKHTMILMYNWFTSSV LYQGLIKHMG
    • Amino acids

      261 to 370
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159538 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MGC32628
    • OCT 2
    • OCT2
    • Organic cation transporter
    • Organic cation transporter 2
    • RP11-317M22.2
    • Solute carrier family 22 (organic cation transporter) member 2
    • Solute carrier family 22 member 2
    see all
  • Relevance

    SLC22A2 (solute carrier family 22 (organic cation transporter), member 2) is an organic cation transporter. Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. SLC22A2 is found primarily in the kidney, where it may mediate the first step in cation reabsorption. It plays important roles in the renal tubular secretion of cationic drugs.
  • Cellular localization

    Plasma membrane

Images

  • ab159538 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159538 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159538.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up