Overview

  • Product name

    Recombinant Human SLC22A6 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      TMIRQTGMGMGSTMARVGSIVSPLVSMTAELYPSMPLFIYGAVPVAASAV TVLLPETLGQPLPDTVQDLESRKGKQTRQQQEHQKYMVPLQASAQEKNGL
    • Amino acids

      451 to 550
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152973 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ55736
    • hOAT1
    • hPAHT
    • hROAT1
    • MGC45260
    • OAT1
    • Organic anion transporter 1
    • OTTHUMP00000236796
    • OTTHUMP00000236797
    • OTTHUMP00000236798
    • OTTHUMP00000236799
    • PAH transporter
    • PAHT
    • Para aminohippurate transporter
    • Renal organic anion transporter 1
    • ROAT1
    • S22A6_HUMAN
    • SLC22A6
    • Solute carrier family 22 (organic anion transporter) member 6
    • Solute carrier family 22 member 6
    see all
  • Function

    Involved in the renal elimination of endogenous and exogenous organic anions. Functions as organic anion exchanger when the uptake of one molecule of organic anion is coupled with an efflux of one molecule of endogenous dicarboxylic acid (glutarate, ketoglutarate, etc). Mediates the sodium-independent uptake of 2,3-dimercapto-1-propanesulfonic acid (DMPS) (By similarity). Mediates the sodium-independent uptake of p-aminohippurate (PAH), ochratoxin (OTA), acyclovir (ACV), 3'-azido-3-'deoxythymidine (AZT), cimetidine (CMD), 2,4-dichloro-phenoxyacetate (2,4-D), hippurate (HA), indoleacetate (IA), indoxyl sulfate (IS) and 3-carboxy-4-methyl-5-propyl-2-furanpropionate (CMPF), cidofovir, adefovir, 9-(2-phosphonylmethoxyethyl) guanine (PMEG), 9-(2-phosphonylmethoxyethyl) diaminopurine (PMEDAP) and edaravone sulfate. PAH uptake is inhibited by p-chloromercuribenzenesulphonate (PCMBS), diethyl pyrocarbonate (DEPC), sulindac, diclofenac, carprofen, glutarate and okadaic acid (By similarity). PAH uptake is inhibited by benzothiazolylcysteine (BTC), S-chlorotrifluoroethylcysteine (CTFC), cysteine S-conjugates S-dichlorovinylcysteine (DCVC), furosemide, steviol, phorbol 12-myristate 13-acetate (PMA), calcium ionophore A23187, benzylpenicillin, furosemide, indomethacin, bumetamide, losartan, probenecid, phenol red, urate, and alpha-ketoglutarate.
  • Tissue specificity

    Strongly expressed in kidney and to a lower extent in liver, skeletal muscle, brain and placenta. Found at the basolateral membrane of the proximal tubule.
  • Sequence similarities

    Belongs to the major facilitator superfamily. Organic cation transporter family.
  • Domain

    Multiple cysteine residues are necessary for proper targeting to the plasma membrane.
  • Post-translational
    modifications

    Glycosylated. Glycosylation at Asn-113 may occur at a secondary level. Glycosylation is necesssary for proper targeting of the transporter to the plasma membrane.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab152973 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152973 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152973.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up