Overview

  • Product name

    Recombinant Human SLC23A2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MMGIGKNTTSKSMEAGSSTEGKYEDEAKHPAFFTLPVVINGGATSSGEQD NEDTELMAIYTTENGIAEKSSLAETLDSTGSLDPQRSDMIYTIEDVPPWY LCIFLGLQHYLTCFSGTIAVPFLLADAMCVGYDQWATSQLIGTIFFCVGI TTLLQTTFGCRLPLFQASAFAFLAPARAILSLDKWKCNTTDVSVANGTAE LLHTEHIWYPRIREIQGAIIMSSLIEVVIGLLGLPGALLKYIGPLTITPT VALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSK KGWTAYKLQLFKMFPIILAILVSWLLCFIFTVTDVFPPDSTKYGFYARTD ARQGVLLVAPWFKVPYPFQWGLPTVSAAGVIGMLSAVVASIIESIGDYYA CARLSCAPPPPIHAINRYVPEKTSS
    • Amino acids

      1 to 425
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160741 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • KIAA0238
    • Na(+)/L ascorbic acid transporter 2
    • NBTL1
    • RP1 237C24.1
    • Sodium dependent vitamin C transporter 2
    • Sodium dependent vitamin C transporter 2 variant II
    • Solute carrier family 23 (nucleobase transporters) member 2
    • SVCT2
    • Yolk sac permease like molecule 2
    • YSPL2
    see all
  • Relevance

    Sodium/ascorbate cotransporter. Mediates electrogenic uptake of vitamin C, with a stoichiometry of 2 Na(+) for each ascorbate.
  • Cellular localization

    Membrane; multi-pass membrane protein.

Images

  • ab160741 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160741 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160741.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up