Overview

  • Product name

    Recombinant Human SLC24A1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      IVKKYTPTPRGEMKSYSPTQVREKVKYTPSPRGRRVGTYVPSTFMTMETS HAITPRTTVKDSDITATYKILETNSLKRIMEETTPTTLKGMFDSTPTFLT HEVEANV
    • Amino acids

      162 to 268
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160373 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CSNB1D
    • HsT17412
    • KIAA0702
    • Na(+)/K(+)/Ca(2+) exchange protein 1
    • Na(+)/K(+)/Ca(2+)-exchange protein 1
    • NCKX
    • NCKX1
    • NCKX1_HUMAN
    • Retinal rod Na Ca+K exchanger
    • Retinal rod Na+/Ca+/K+ exchanger
    • Retinal rod Na-Ca+K exchanger
    • RODX
    • Slc24a1
    • Sodium/potassium/calcium exchanger 1
    • Solute carrier family 24 (sodium/potassium/calcium exchanger) member 1
    • Solute carrier family 24 member 1
    see all
  • Function

    Critical component of the visual transduction cascade, controlling the calcium concentration of outer segments during light and darkness. Light causes a rapid lowering of cytosolic free calcium in the outer segment of both retinal rod and cone photoreceptors and the light-induced lowering of calcium is caused by extrusion via this protein which plays a key role in the process of light adaptation. Transports 1 Ca(2+) and 1 K(+) in exchange for 4 Na(+).
  • Tissue specificity

    Expressed in the retina, particularly in the inner segment, outer and inner nuclear layers, and ganglion cell layer.
  • Involvement in disease

    Defects in SLC24A1 are the cause of congenital stationary night blindness type 1D (CSNB1D) [MIM:613830]. An autosomal recessive form of congenital stationary night blindness a non-progressive retinal disorder characterized by impaired night vision. CSNB1D is characterized by a Riggs type of electroretinogram (proportionally reduced a- and b-waves). Patients have visual acuity within the normal range and no symptoms of myopia and/or nystagmus.
  • Sequence similarities

    Belongs to the sodium/potassium/calcium exchanger family. SLC24A subfamily.
  • Post-translational
    modifications

    The uncleaved signal sequence is required for efficient membrane targeting and proper membrane integration.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab160373 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160373 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160373.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up