Overview

  • Product name
    Recombinant Human SLC25A12 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KEIFGQTIIHHHIPFNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEH ARQAFALKDKSKSGMISGLDFS
    • Amino acids
      112 to 183
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160108 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AGC1
    • Araceli hiperlarga
    • ARALAR
    • ARALAR1
    • Calcium binding mitochondrial carrier superfamily member
    • Calcium binding mitochondrial carrier superfamily member Aralar1
    • Calcium-binding mitochondrial carrier protein Aralar1
    • CMC1_HUMAN
    • Mitochondrial aspartate glutamate carrier 1
    • SLC25A12
    • Solute carrier family 25 (aspartate/glutamate carrier) member 12
    • Solute carrier family 25 (mitochondrial carrier Aralar) member 12
    • Solute carrier family 25 member 12
    • solute carrier family 25, member 12
    see all
  • Function
    Calcium-dependent mitochondrial aspartate and glutamate carrier. May have a function in the urea cycle.
  • Tissue specificity
    High levels in heart and skeletal muscle, low in brain and very low in kidney.
  • Involvement in disease
    Defects in SLC25A12 are the cause of aspartate-glutamate carrier 1 deficiency (AGC1D) [MIM:612949]; also called global cerebral hypomyelination. This syndrome consists of a child severe psychomotor retardation, hypotonia and hypomyelination of the central nervous system.
  • Sequence similarities
    Belongs to the mitochondrial carrier family.
    Contains 4 EF-hand domains.
    Contains 3 Solcar repeats.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab160108 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160108 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160108.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up