Description

  • Product name

    Recombinant Human SLC25A21/ODC protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      VVKTRFQIQRCATDPNSYKSLVDSFRMIFQMEGLFGFYKGILPPILAETP KRAVKFFTFEQYKK
    • Amino acids

      36 to 99
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164791 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as SLC25A21

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Mitochondrial 2-oxodicarboxylate carrier
    • ODC
    • ODC_HUMAN
    • ODC1
    • oxodicarboxylate carrier
    • Slc25a21
    • Solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21
    • Solute carrier family 25 member 21
    see all
  • Function

    Transports C5-C7 oxodicarboxylates across the inner membranes of mitochondria. Can transport 2-oxoadipate, 2-oxoglutarate, adipate, glutarate, and to a lesser extent, pimelate, 2-oxopimelate, 2-aminoadipate, oxaloacetate, and citrate.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the mitochondrial carrier family.
    Contains 3 Solcar repeats.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab164791 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164791 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164791.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up