Overview

  • Product name

    Recombinant Human SLC25A23 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MRGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGA QQGISSEGDADPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVS EIQQSFRALGISISLEQAEKILHSMDRDGTMTIDWQEWRDHFLLHSLENV EDVLYFWKHSTLSSAGFSAWIKDSTAEQNRSKTTVLARRSGSHLKSQHFG RPKWADHEVLDIGECLTVPDEFSKQEKLTGMWWKQLVAGAVAGAVSRTGT APLDRLKVFMQVHASKTNRLNILGGLRSMVLEGGIRSLWRGNGINVLKIA PESAIKFMAYEQIKRAILGQQETLHVQERFVAGSLAGATAQTIIYPMEVL KTRLTLRRTGQYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDL AVYETLKNWWLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALVRTR MQAQGWSTVARFQITATSAFQVQAILLPQPPE
    • Amino acids

      1 to 482
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163976 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • APC2
    • Calcium binding mitochondrial carrier protein SCaMC3
    • FLJ30339
    • MCSC2
    • MGC2615
    • Mitochondrial ATP Mg/Pi carrier protein 2
    • Mitochondrial Ca(2+) dependent solute carrier protein 2
    • SCAMC3
    • Small calcium binding mitochondrial carrier protein 3
    • Solute carrier family 25 member 23
    see all
  • Relevance

    SLC25A23 is a calcium dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.
  • Cellular localization

    Mitochondrial inner membrane; Multi pass membrane protein

Images

  • ab163976 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163976 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163976.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up