Overview

  • Product name

    Recombinant Human SLC26A2/DTD protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSSESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRP YHRILIERQEKSDTNFKEFVIKKLQKNCQCSPAKAKNMILGFLPVLQWLP KYDLKKNI
    • Amino acids

      1 to 108
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158322 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as SLC26A2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • D5S1708
    • Diastrophic dysplasia protein
    • Diastrophic dysplasia sulfate transporter
    • DTD
    • DTDST
    • EDM 4
    • EDM4
    • MST 153
    • MST153
    • MSTP 157
    • MSTP157
    • Solute carrier family 26 (anion exchanger) member 2
    • Solute carrier family 26 (sulfate transporter) member 2
    • Solute carrier family 26 member 2
    • Sulfate anion transporter 1
    • Sulfate transporter
    see all
  • Relevance

    SLC26A2, or diastrophic dysplasia sulfate transporter, is a glycoprotein implicated in the pathogenesis of several forms of chondrodysplasia. This gene is implicated in sulfation of proteoglycans and matrix organization in the cartilage and may play a role in endochondral bone formation. Sulfate transporter.
  • Cellular localization

    Membrane; Multi-pass membrane protein.

Images

  • ab158322 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158322 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158322.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up