Overview

  • Product name

    Recombinant Human SLC26A4 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAAPGGRSEPPQLPEYSCSYMVSRPVYSELAFQQQHERRLQERKTLRESL AKCCSCSRKRAFGVLKTLVPILEWLPKYRVKEWLLSDVISGVSTGLVATL QGMAYALLAAVPVGYGLYSAFFPILTYFIFGTSRHISVGPFPVVSLMVGS VVLSMAPDEHFLVSSSNGTVLNTTMIDTAARDTARVLIASALTLLVGIIQ LIFGGLQIGFIVRYLADPLVGGFTTAAAFQVLVSQLKIVLNVSTKNYNGV LSIIYTLVEIFQNIGDTNLADFTAGLLTIVVCMAVKELNDRFRHKIPVPI PIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFLPPELPPVSLFSEML AASFSIAVVAYAIAVSVGKVYATKYDYTIDGNQEFIAFGISNIFSGFFSC FVATTALSRTAVQESTGGKTQVAGIISAAIVMIAILALGKLLEPLQKSVL AAVVIANLKGMFMQLCDIPRLWRQNKIDAVIWVFTCIVSIILGLDLGLLA GLIFGLLTVVLRVQFPSWNGLGSIPSTDIYKSTKNYKNIEEPQGVKILRF SSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKSGQLRAT KNGIISDAVSTNNAFEPDEDIEDLEELDIPTKEIEIQVDWNSELPVKVNV PKVPIHSLVLDCGAISFLDVVGVRSLRVIVKEFQRIDVNVYFASLQDYVI EKLEQCGFFDDNIRKDTFFLTVHDAILYLQNQVKSQEGQGSILETITLIQ DCKDTLELIETELTEEELDVQDEAMRTLAS
    • Molecular weight

      113 kDa including tags
    • Amino acids

      1 to 780

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132582 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • deafness, autosomal recessive 4
    • DFNB4
    • EVA
    • NSRD4
    • PDS
    • Pendred syndrome
    • Pendred syndrome homolog
    • Pendrin
    • S26A4_HUMAN
    • SLC26A4
    • Sodium independent chloride/iodide transporter
    • Sodium-independent chloride/iodide transporter
    • Solute carrier family 26 member 4
    see all
  • Function

    Sodium-independent transporter of chloride and iodide.
  • Tissue specificity

    High expression in adult thyroid, lower expression in adult and fetal kidney and fetal brain. Not expressed in other tissues.
  • Involvement in disease

    Pendred syndrome
    Deafness, autosomal recessive, 4
  • Sequence similarities

    Belongs to the SLC26A/SulP transporter (TC 2.A.53) family.
    Contains 1 STAS domain.
  • Cellular localization

    Membrane. Cell membrane. Localizes to the apical brush border of cells in the cortical collecting ducts of the kidney.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132582 stained with Coomassie Blue.

References

ab132582 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132582.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up