Overview

  • Product name
    Recombinant Human SLC26A9 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QTQFRNGYALAQVMDTDIYVNPKTYNRAQDIQGIKIITYCSPLYFANSEI FRQKVIAKTGMDPQKVLLAKQKYLKKQEKRRMRPTQQRRSLFMKTKTVSL QELQQDFENA
    • Amino acids
      496 to 605
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165060 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Anion transporter/exchanger 9
    • Anion transporter/exchanger protein 9
    • OTTHUMP00000034236
    • OTTHUMP00000034326
    • Solute carrier family 26 member 9
    see all
  • Relevance
    SLC26A9 is one member of a family of sulfate/anion transporter genes. It is a DIDS- and thiosulfate-sensitive anion exchanger mediating chloride, sulfate and oxalate transport. It mediates chloride/bicarbonate exchange or chloride-independent bicarbonate extrusion thus assuring bicarbonate secretion and is inhibited by ammonium and thiosulfate. It is predominantly expressed in lung at the luminal side of the bronchiolar and alveolar epithelium of lung and to a lower extent is also expressed in pancreas and prostate.
  • Cellular localization
    Membrane; Multi-pass membrane protein.

Images

  • ab165060 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165060 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165060.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up