Description

  • Product name

    Recombinant Human SLC27A4 / FATP4 protein
    See all SLC27A4 / FATP4 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPLTLSTLLQPGRIWTGRRAAEPTPGHNAAWSLSGGGAAVLQAGAETALD PGGILPVVPLLGIWRLALHPGLHQDHQAYLTGDVLVMDELGYLYFRDRTG DTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAVASP TGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTELRKEGF DPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL
    • Predicted molecular weight

      52 kDa including tags
    • Amino acids

      1 to 237
    • Additional sequence information

      This is the full length protein sequence for isoform 2 UniProt: Q6P1M0-2 (AAH09959.1).

Specifications

Our Abpromise guarantee covers the use of ab132824 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ACSVL 4
    • ACSVL4
    • EC 6.2.1
    • FATP 4
    • FATP4
    • Fatty acid transport protein 4
    • Fatty acid transport protein4
    • IPS
    • Long chain fatty acid transport protein 4
    • Long chain fatty acid transport protein4
    • OTTHUMP00000022264
    • S27A4
    • SLC27 A4
    • SLC27A 4
    • Solute carrier family 27 (fatty acid transporter) member 4
    • Solute carrier family 27 member 4
    • Solute carrier family 27 member4
    see all
  • Relevance

    SLC27A4 / FATP4 plays a role in the transport of long chain fatty acids across the plasma membrane. It has acyl-coA ligase activity for long chain and very long chain fatty acids. Deletion of the SLC27A4 gene results in embryonic lethality, which is attributed to the need for fat absorption across the visceral endoderm early in embryonic development. Expression of FAT4P in the intestinal lining is thought to be altered in response to dietary fat.
  • Cellular localization

    Cell Membrane

Images

  • 12.5% SDS-PAGE analysis of ab132824 stained with Coomassie Blue.

References

ab132824 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132824.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up