Recombinant Human SLC27A5 / BAL protein (ab161232)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGVRQQLALLLLLLLLLWGLGQPVWPVAVALTLRWLLGDPTCCVLLGLAM LARPWLGPWVPHGLSLAAAALALTLLPARLPPGLRWLPADVIFLAKILHL GLKIRGCLSRQPPDTFVDAFERRARAQPGRALLVWTGPGAGSVTFGELDA RACQAAWALKAELGDPASLCAGEPTALLVLASQAVPALCMWLGLAKLGCP TAWINPHGRGMPLAHSVLSSGARVLVVDPDLRESLEEILPKLQAENIRCF YLSHTSPTPGVGALGAALDAAPSHPVPADLRAGITWRSPALFIYTSGTTG LPKPAILTHERVLQMSKMLSLSGATADDVVYTVLPLYHVMGLVVGILGCL DLGATCVLAPKFSTSCFWDDCRQHGVTVILYVGELLRYLCNIPQQPEDRT HTVRLAMGNGLRADVWETFQQRFGPIRIWEVYGSTEGNMGLVNYVGRCGA LGKMSCLLRMLSPFELVQFDMEAAEPVRDNQGFCIPVGLGEPGLLLTKVV SQQPFVGYRGPRELSERKLVRNVRQSGDVYYNTGDVLAMDREGFLYFRDR LGDTFRWKGENVSTHEVEGVLSQVDFLQQVNVYGVCVPGCEGKVGMAAVQ LAPGQTFDGEKLYQHVRAWLPAYATPHFIRIQDAMEVTSTFKLMKTRLVR EGFNVGIVVDPLFVLDNRAQSFRPLTAEMYQAVCEGTWRL
    • Amino acids
      1 to 690
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161232 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Product previously known as SLC27A5.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACSB
    • ACSVL6
    • BA CoA ligase
    • BA-CoA ligase
    • BACS
    • BAL
    • Bile acid CoA ligase
    • Bile acid-CoA ligase
    • Bile acyl CoA synthetase
    • Bile acyl-CoA synthetase
    • Cholate CoA ligase
    • Cholate--CoA ligase
    • FACVL3
    • FATP 5
    • FATP-5
    • FATP5
    • Fatty acid Coenzyme A ligase very long chain 3
    • Fatty acid transport protein 5
    • Fatty-acid-coenzyme A ligase
    • FLJ22987
    • S27A5_HUMAN
    • Slc27a5
    • Solute carrier family 27 (fatty acid transporter) member 5
    • Solute carrier family 27 member 5
    • Very long chain acyl CoA synthetase homolog 2
    • Very long chain acyl CoA synthetase related protein
    • very long-chain 3
    • Very long-chain acyl-CoA synthetase homolog 2
    • Very long-chain acyl-CoA synthetase-related protein
    • VLACS related
    • VLACS-related
    • VLACSR
    • VLCS H2
    • VLCS-H2
    • VLCSH2
    see all
  • Function
    Acyl-CoA synthetase involved in bile acid metabolism. Proposed to catalyze the first step in the conjugation of C24 bile acids (choloneates) to glycine and taurine before excretion into bile canaliculi by activating them to their CoA thioesters. Seems to activate secondary bile acids entering the liver from the enterohepatic circulation. In vitro, also activates 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholestanate (THCA), the C27 precursor of cholic acid deriving from the de novo synthesis from cholesterol.
  • Tissue specificity
    Predominantly expressed in liver.
  • Sequence similarities
    Belongs to the ATP-dependent AMP-binding enzyme family.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab161232 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161232 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161232.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up