Overview

  • Product name
    Recombinant Human SLC27A6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLLSWLTVLGAGMVVLHFVQKLLFTYFWDDFWFVLKVVLIIIRLKKYEKR GELVTVLDKFLSHAKRQPRKPFIIYEGDIYTYQDVDKRSSRVAHVFLNHS SLKKGDTVALLMSNEPDFVHVWFGLAKLGCVVAFLNTNIRSNSLLNCIRA CGPRALVVGADLLGTVEEILPSLSENISVWGMKDSVPQGVISLKEKLSTS PDEPVPRSHHVVSLIKSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWA FGCTAHDIVYITLPLYHSSAAILGISGCVELGATCVLKKKFSASQFWSDC KKYDVTVFQYIGELCRYLCKQSKREGEKDHKVRLAIGNGIRSDVWREFLD RFGNIKVCELYAATESSISFMNYTGRIGAIGRTNLFYKLLSTFDLIKYDF QKDEPMRNEQGWCIHVKKGEPGLLISRVNAKNPFFGYAGPYKHTKDKLLC DVFKKGDVYLNTGDLIVQDQDNFLYFWDRTGDTFRWKGENVATTEVADVI GMLDFIQEANVYGVAISGYEGRAGMASIILKPNTSLDLEKVYEQVVTFLP AYACPRFLRIQEKMEATGTFKLLKHQLVEDGFNPLKISEPLYFMDNLKKS YVLLTRELYDQIMLGEIKL
    • Amino acids
      1 to 619
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162185 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACSVL2
    • FACVL2
    • FATP 6
    • FATP-6
    • FATP1
    • FATP6
    • Fatty acid coenzyme A ligase, very long chain 2
    • Fatty acid transport protein 6
    • Fatty-acid-coenzyme A ligase
    • hVLCS H1
    • hVLCS-H1
    • Long-chain fatty acid transport protein 6
    • S27A6_HUMAN
    • SLC27A6
    • solute carrier family 27 fatty acid transporter member 6
    • Solute carrier family 27 member 6
    • Very long chain acyl CoA synthetase homolog 1
    • very long-chain 2
    • Very long-chain acyl-CoA synthetase homolog 1
    • VLCS H1
    • VLCSH1
    see all
  • Function
    Involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. Thought to function as the predominant fatty acid protein transporter in heart.
  • Tissue specificity
    Strongly expressed in heart and localizes to cardiac myocytes. Expressed at moderate levels in placenta, testis, and adrenal glands. Expressed at very low levels in kidney, bladder and uterus.
  • Sequence similarities
    Belongs to the ATP-dependent AMP-binding enzyme family.
  • Cellular localization
    Membrane. Cell membrane > sarcolemma. In heart is exclusively located on the sarcolemma in areas juxtaposed with small blood vessels where it colocalizes CD36.
  • Information by UniProt

Images

  • ab162185 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162185 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162185.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up