Overview

  • Product name
    Recombinant Human SLC2A4RG protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EAAHFLFGEPTLRKRKSPAQVMFQCLWKSCGKVLSTASAMQRHIRLVHLG RQAEPEQSDGEEDFYYTELDVGVDTLTDGLSSLTPVSPTASM
    • Amino acids
      178 to 269
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163398 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GEF
    • GLUT4 enhancer factor
    • HDBP 1
    • HDBP-1
    • HDBP1
    • Huntington disease gene regulatory region binding protein 1
    • Huntington disease gene regulatory region-binding protein 1
    • S2A4R_HUMAN
    • Si 1 2
    • Si 1 2 19
    • SLC2A4 regulator
    • SLC2A4RG
    • Zinc finger protein 2 5 Glut4 enhancer factor
    see all
  • Function
    Transcription factor involved in SLC2A4 and HD gene transactivation. Binds to the consensus sequence 5'-GCCGGCG-3'.
  • Tissue specificity
    According to PubMed:14630949, expressed in heart, skeletal muscle, liver, kidney and pancreas; undetectable in lung, placenta or brain. According to PubMed:14625278, ubiquitously expressed, with lowest expression in brain and ileum.
  • Sequence similarities
    Contains 1 C2H2-type zinc finger.
  • Cellular localization
    Cytoplasm. Nucleus. Shuttles between the cytoplasm and the nucleus.
  • Information by UniProt

Images

  • ab163398 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163398 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163398.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up