Description

  • Product name

    Recombinant human SLC31A1 / CTR1 protein (Active)
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized ab235610 at 5 μg/ml can bind human LGALS8, the EC50 of human LGALS8 is 373.90-524.30 μg/ml.

  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFG FKNVELLFSGLVINTAGEMAGAFVAVFLLAMFYEGLKIARESLLRKSQVS IRYNSMPVPGPNGTILMETHKTVGQQMLSFPHLLQTVLHIIQVVISYFLM LIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      1 to 190
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-SUMO-tagged. In vitro E.coli expression system.

Specifications

Our Abpromise guarantee covers the use of ab235610 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Copper transport 1 homolog
    • Copper transporter 1
    • COPT1
    • COPT1_HUMAN
    • CTR1
    • hCTR1
    • High affinity copper uptake protein 1
    • SLC31A1
    • solute carrier family 31 (copper tansporters) member 1
    • Solute carrier family 31 member 1
    see all
  • Function

    High-affinity, saturable copper transporter involved in dietary copper uptake.
  • Sequence similarities

    Belongs to the copper transporter (Ctr) (TC 1.A.56) family. SLC31A subfamily.
  • Post-translational
    modifications

    O-Glycosylation at Thr-27 protects from proteolytic cleavage in the N-terminal extracellular domain.
  • Cellular localization

    Cell membrane. Localizes to the apical membrane in intestinal epithelial cells.
  • Information by UniProt

Images

  • ab235610 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • Measured by its binding ability in a functional ELISA. Immobilized ab235610 at 5 μg/ml can bind human LGALS8, the EC50 of human LGALS8 is 373.90-524.30 μg/ml.

References

ab235610 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235610.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up