Overview

  • Product name

    Recombinant Human SLC35A1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCI TEVIKLLLSVGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAV QNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWVSVFM LCAGVTLVQWKPAQATKVVVEQNPLLGFGAIAIAVLCSGFAGVYFEKVLK SSDTSLWVRNIQMYLSGIIVTLAGVYLSDGAEIKEKGFFYGYTYYVWFVI FLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVMLFGLQITLTFA LGTLLVCVSIYLYGLPRQDTTSIQQGETASKERVIGV
    • Amino acids

      1 to 337
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161044 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CMP-SA-Tr
    • CMP-Sia-Tr
    • CMP-sialic acid transporter
    • S35A1_HUMAN
    • Slc35a1
    • Solute carrier family 35 member A1
    see all
  • Function

    Transports CMP-sialic acid from the cytosol into Golgi vesicles where glycosyltransferases function.
  • Involvement in disease

    Defects in SLC35A1 are the cause of congenital disorder of glycosylation type 2F (CDG2F) [MIM:603585]. CDGs are a family of severe inherited diseases caused by a defect in protein N-glycosylation. They are characterized by under-glycosylated serum proteins. These multisystem disorders present with a wide variety of clinical features, such as disorders of the nervous system development, psychomotor retardation, dysmorphic features, hypotonia, coagulation disorders, and immunodeficiency. The broad spectrum of features reflects the critical role of N-glycoproteins during embryonic development, differentiation, and maintenance of cell functions.
  • Sequence similarities

    Belongs to the nucleotide-sugar transporter family. SLC35A subfamily.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab161044 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161044 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161044.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up