Overview

  • Product name

    Recombinant Human SLC35B2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MDARWWAVVVLAAFPSLGAGGETPEAPPESWTQLWFFRFVVNAAGYASFM VPGYLLVQYFRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEA AETTPMWQALKLLFCATGLQVSYLTWGVLQERVMTRSYGATATSPGERFT DSQFLVLMNRVLALIVAGLSCVLCKQPRHGAPMYRYSFASLSNVLSSWCQ YEALKFVSFPTQVLAKASKVIPVMLMGKLVSRRSYEHWEYLTATLISIGV SMFLLSSGPEPRSSPATTLSGLILLAGYIAFDSFTSNWQDALFAYKMSSV QMMFGVNFFSCLFTVGSLLEQGALLEGTRFMGRHSEFAAHALLLSICSAC GQLFIFYTIGQFGAAVFTIIMTLRQAFAILLSCLLYGHTVTVVGGLGVAV VFAALLLRVYARGRLKQRGKKAVPVESPVQKV
    • Amino acids

      1 to 432
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166331 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Adenosine 3'-phospho 5'-phosphosulfate transporter 1
    • PAPS transporter 1
    • PAPST1
    • PSEC0149
    • Putative MAPK-activating protein PM15
    • Putative NF-kappa-B-activating protein 48
    • SLC35B2
    • SLL
    • Solute carrier family 35, member B2
    • UGTrel4
    see all
  • Relevance

    Sulfotransferases use an activated form of sulfate, 3-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS), as a common sulfate donor for sulfation of glycoproteins, proteoglycans, and glycolipids in the endoplasmic reticulum and Golgi apparatus. SLC35B2 is located in the microsomal membrane and transports PAPS from the cytosol, where it is synthesized, into the Golgi lumen.
  • Cellular localization

    Golgi apparatus membrane; Multi-pass membrane protein

Images

  • ab166331 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166331 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166331.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up