Overview

  • Product name

    Recombinant Human SLC35D2/HFRC protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MTAGGQAEAEGAGGEPGAARLPSRVARLLSALFYGTCSFLIVLVNKALLT TYGFPSPIFLGIGQMAATIMILYVSKLNKIIHFPDFDKKIPVKLFPLPLL YVGNHISGLSSTSKLSLPMFTVLRKFTIPLTLLLETIILGKQYSLNIILS VFAIILGAFIAAGFLLMYSTVLCSYYNSALTTAVVGAIKNVSVAYIGILI GGDYIFSLLNFVGLNICMAGGLRYSFLTLSSQLKPKPVGEENICLDLKS
    • Amino acids

      1 to 249
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161266 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as SLC35D2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Fringe connection
    • Hfrc
    • HFRC 1
    • HFRC1
    • Homolog of Fringe connection protein 1
    • MGC117215
    • MGC142139
    • Nucleotide sugar transporter UGTrel8
    • S35D2_HUMAN
    • SLC35D2
    • Solute carrier family 35 member D2
    • SQV 7L
    • SQV7-like protein
    • SQV7L
    • UDP N acetylglucosamine transporter
    • UDP-galactose transporter-related protein 8
    • UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter
    • UGTrel 8
    • UGTrel8
    see all
  • Function

    Antiporter transporting nucleotide sugars such as UDP-N-acetylglucosamine (UDP-GlcNAc), UDP-glucose (UDP-Glc) and GDP-mannose (GDP-Man) pooled in the cytosol into the lumen of the Golgi in exchange for the corresponding nucleosides monophosphates (UMP for UDP-sugars and GMP for GDP-sugars). May take part in heparan sulfate synthesis by supplying UDP-Glc-NAc, the donor substrate, and thus be involved in growth factor signaling.
  • Tissue specificity

    Highly expressed in heart, kidney, small intestine, placenta, lung and peripheral blood leukocyte. Weakly expressed in skeletal muscle and spleen. Not expressed in brain, colon and thymus.
  • Sequence similarities

    Belongs to the TPT transporter family. SLC35D subfamily.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab161266 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161266 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161266.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up