Overview

  • Product name
    Recombinant Human SLC35F1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIPPEQPQQQLQPPSPAPPNHVVTTIENLPAEGSGGGGSLSASSRAGVRQ RIRKVLNREMLISVALGQVLSLLICGIGLTSKYLSEDFHANTPVFQSFLN YILLFLVYTTTLAVRQGEENLLAILRRRWWKYMILGLIDLEANYLVVKAY QYTNLTSIQLLDCFVIPVVILLSWFFLLIRYKAVHFIGIVVCILGMGCMV GADVLVGRHQGAGENKLVGDLLVLGGATLYGISNVWEEYIIRTLSRVEFL GMIGLFGAFFSGIQLAIMEHKELLKVPWDWQIGLLYVGFSACMFGLYSFM QVVIKKTSATSVNLSLLTADLYSLFCGLFLFHYKFSGLYLLSFFTILIGL VLYSSTSTYIAQDPRVYKQFRNPSGPVVDLPTTAQVEPSVTYTSLGQETE EEPHVRVA
    • Amino acids
      1 to 408
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165993 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C6orf169
    • dJ230I3.1
    • FLJ13018
    • S35F1_HUMAN
    • Slc35f1
    • Solute carrier family 35 member F1
    see all
  • Function
    Putative solute transporter.
  • Sequence similarities
    Belongs to the SLC35F solute transporter family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab165993 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165993 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165993.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up