Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSVTKSTEGPQGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKK TKGITVFQALIHLVKGNMGTG
    • Amino acids
      1 to 71
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165659 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A530067G19Rik
    • FLJ16051
    • MGC119658
    • MGC119660
    • PAT2
    • Proton coupled amino acid transporter 2
    • Proton/amino acid transporter 2
    • Solute carrier family 36 (proton/amino acid symporter) member 2
    • Solute carrier family 36 member 2
    • TRAMD1
    • Tramdorin
    • Tramdorin 1
    see all
  • Relevance
    SLC36A2 belongs to the amino acid/polyamine transporter 2 family and is involved in a pH-dependent electrogenic neuronal transport and sequestration of small amino acids such as glycine, alanine and proline. It is inhibited by sarcosine.
  • Cellular localization
    Cell membrane; Multi-pass membrane protein. Cytoplasm.

Images

  • ab165659 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165659 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165659.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up