Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAAQGYGYYRTVIFSAMFGGYSLYYFNRKTFSFVMPSLVEEIPLDKDDLG FITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLVGLVNIFFAWSSTV PVFAALWFLNGLAQGLGWPPCGKVLRKWFEPSQFGTWWAILSTSMNLAGG LGPILATILAQSYSWRSTLALSGALCVVVSFLCLLLIHNEPADVGLRNLD PMPSEGKKGSLKEESTLQELLLSPYLWVLSTGYLVVFGVKTCCTDWGQFF LIQEKGQSALVGSSYMSALEVGGLVGSIAAGYLSDRAMAKAGLSNYGNPR HGLLLFMMAGMTVSMYLFRVTVTSDSPKLWILVLGAVFGFSSYGPIALFG VIANESAPPNLCGTSHAIVGLMANVGGFLAGLPFSTIAKHYSWSTAFWVA EVICAASTAAFFLLRNIRTKMGRVSKKAE
    • Molecular weight

      73 kDa including tags
    • Amino acids

      1 to 429

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132873 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • G6PT1
    • G6PT1_HUMAN
    • G6PT2
    • G6PT3
    • Glucose-5-phosphate transporter
    • Glucose-6-phosphatase, transport (glucose) protein 3
    • Glucose-6-phosphatase, transport (glucose-6-phosphate) protein 1
    • Glucose-6-phosphatase, transport (phosphate/pyrophosphate) protein 2;
    • Glucose-6-phosphate translocase
    • Glucose-6-phosphate transporter 1
    • GSD1b
    • GSD1c
    • GSD1d
    • MGC15729
    • Microsomal glucose-6-phosphate transporter
    • PRO0685
    • SLC37A4
    • Solute carrier family 37 (glucose-6-phosphate transporter), member 4
    • Solute carrier family 37 member 4
    • Transformation-related gene 19 protein
    • TRG-19
    • TRG19
    see all
  • Function

    Transports glucose-6-phosphate from the cytoplasm to the lumen of the endoplasmic reticulum. Forms with glucose-6-phosphatase the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it plays a central role in homeostatic regulation of blood glucose levels.
  • Tissue specificity

    Mostly expressed in liver and kidney.
  • Involvement in disease

    Defects in SLC37A4 are the cause of glycogen storage disease type 1B (GSD1B) [MIM:232220]. GSD1B is a metabolic disorder characterized by impairment of terminal steps of glycogenolysis and gluconeogenesis. GSD1 patients manifest a wide range of clinical symptoms and biochemical abnormalities, including hypoglycemia, severe hepatomegaly due to excessive accumulation of glycogen, kidney enlargement, growth retardation, lactic acidemia, hyperlipidemia, and hyperuricemia. GSD1B patients also present a tendency towards infections associated with neutropenia, relapsing aphthous gingivostomatitis, and inflammatory bowel disease.
    Defects in SLC37A4 are the cause of glycogen storage disease type 1C (GSD1C) [MIM:232240].
    Defects in SLC37A4 are the cause of glycogen storage disease type 1D (GSD1D) [MIM:232240].
  • Sequence similarities

    Belongs to the major facilitator superfamily. Organophosphate:Pi antiporter (OPA) (TC 2.A.1.4) family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132873 stained with Coomassie Blue.

References

ab132873 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132873.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up