Overview

  • Product name
    Recombinant Human SLC44A1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TKLEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSVALCVAACPRQELK TLSDVQKFAEINGSALCSYNLKPSEYTTSPKSSVLCPKLPVPASAPIPFF HRCAPVNISC
    • Amino acids
      74 to 183
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161651 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD 92
    • CD92
    • CD92 antigen
    • CD92 protein
    • CDW 92
    • CDw92
    • CDW92 antigen
    • Choline transporter like protein 1
    • Choline transporter-like protein 1
    • CHTL 1
    • CHTL1
    • CTL 1
    • CTL1
    • CTL1_HUMAN
    • RP11 287A8.1
    • slc44a1
    • Solute carrier family 44 member 1
    see all
  • Function
    Choline transporter. May be involved in membrane synthesis and myelin production.
  • Tissue specificity
    Expressed in various cells of the hematopoietic system.
  • Sequence similarities
    Belongs to the CTL (choline transporter-like) family.
  • Cellular localization
    Cell membrane. Mitochondrion outer membrane.
  • Information by UniProt

Images

  • ab161651 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161651 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161651.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up