Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSTENVEGKPSNLGERGRARSSTFLRVVQPMFNHSIFTSAVSPAAERIRF ILGEEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGER WSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIVDHQIETG LLKPELKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDNG SPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDF LDTPFIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAI ATLMSDEVFHDIAYKAKDRHDLIAGIDEFLDEVIVLPPGEWDPAIRIEPP KSLPSSDKRKNMYSGGENVQMNGDTPHDGGHGGGGHGDCEELQRTGRFCG GLIKDIKRKAPFFASDFYDALNIQALSAILFIYLATVTNAITFGGLLGDA TDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSK DNNFDYLEFRLWIGLWSAFLCLILVATDASFLVQYFTRFTEEGFSSLISF IFIYDAFKKMIKLADYYPINSNFKVGYNTLFSCTCVPPDPGEGITLCVYA RFVFGGRCRLHACKFSTCCHGPQELVLFFSLKNSATEFDVSLPEVF
    • Molecular weight

      97 kDa including tags
    • Amino acids

      1 to 646

Specifications

Our Abpromise guarantee covers the use of ab132372 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

    Protein previously labeled as SLC4A4.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZp781H1314
    • Electrogenic sodium bicarbonate cotransporter 1
    • hhNMC
    • HNBC 1
    • HNBC1
    • KNBC
    • kNBC 1
    • kNBC1
    • Na(+)/HCO3(-) cotransporter
    • Na+HCO3- cotransporter 4
    • NBC 1
    • NBC 2
    • NBC1
    • NBC2
    • Nbc4
    • NBCE 1
    • NBCE1
    • OTTHUMP00000160355
    • OTTHUMP00000218884
    • OTTHUMP00000218885
    • PNBC
    • S4A4_HUMAN
    • SLC4A4
    • SLC4A5
    • Sodium bicarbonate cotransporter
    • Sodium bicarbonate cotransporter 1 (sodium bicarbonate cotransporter, kidney; sodium bicarbonate cotransporter, pancreas)
    • Sodium bicarbonate cotransporter kidney
    • sodium bicarbonate cotransporter member 4
    • Sodium bicarbonate cotransporter pancreas
    • Solute carrier family 4 member 4
    • Solute carrier family 4 sodium bicarbonate cotransporter member 4
    • Solute carrier family 4 sodium bicarbonate cotransporter member 5
    • Solute carrier family 4, sodium bicarbonate cotransporter, member 4, brain type
    see all
  • Function

    Electrogenic sodium/bicarbonate cotransporter with a Na(+):HCO3(-) stoichiometry varying from 1:2 to 1:3. May regulate bicarbonate influx/efflux at the basolateral membrane of cells and regulate intracellular pH.
  • Tissue specificity

    Isoform 1 is expressed in pancreas and to a lower extent in heart, skeletal muscle, liver, parotid salivary glands, prostate, colon, stomach, thyroid, brain and spinal chord. Corneal endothelium cells express only isoform 1 (at protein level). Isoform 2 is specifically expressed in kidney at the level of proximal tubules.
  • Involvement in disease

    Defects in SLC4A4 are the cause of proximal renal tubular acidosis with ocular abnormalities (pRTA-OA) [MIM:604278]; also known as renal tubular acidosis II. Caused by an impairment of bicarbonate absorption in the proximal tubule, proximal renal tubular acidosis (pRTA) is characterized by a decreased renal HCO3(-) threshold. pRTA-OA is an extremely rare autosomal recessive syndrome characterized by short stature, profound pRTA, mental retardation, bilateral glaucoma, cataracts and bandkeratopathy.
    Note=Loss of interaction with and stimulation by CA4 is the cause of retinitis pigmentosa type 17 (RP17).
  • Sequence similarities

    Belongs to the anion exchanger (TC 2.A.31) family.
  • Post-translational
    modifications

    Phosphorylation of Ser-1026 by PKA increases the binding of CA2 and changes the Na(+):HCO3(-) stoichiometry of the transporter from 3:1 to 2:1. Phosphorylation of Thr-49 regulates isoform 1 conductance.
    N-glycosylation is not necessary for the transporter basic functions.
  • Cellular localization

    Basolateral cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132372 stained with Coomassie Blue.

References

ab132372 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132372.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up