Recombinant Human SLC4A8 / NBC protein (ab160512)

Overview

  • Product name
    Recombinant Human SLC4A8 / NBC protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IEEISDLILDQQELSSDLNDSMRVKVREALLKKHHHQNEKKRNNLIPIVR SFAEVGKKQSDPHLMDKHGQTVSPQSVPTTNLEVKNGVNCEHSPVDLSKV
    • Amino acids
      187 to 286
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160512 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously labeled as SLC4A8.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Electroneutral Na(+)-driven Cl-HCO3 exchanger
    • Electroneutral sodium bicarbonate exchanger 1
    • k-NBC3
    • S4A8_HUMAN
    • Slc4a8
    • SLC4A8 protein
    • Solute carrier family 4 member 8
    see all
  • Function
    Mediates electroneutral sodium- and carbonate-dependent choride-HCO3(-) exchange with a Na(+):HCO3(-) stoichiometry of 2:1. Plays a major role in pH regulation in neurons. May be involved in cell pH regulation by transporting HCO3(-) from blood to cell. Enhanced expression in severe acid stress could be important for cell survival by mediating the influx of HCO3(-) into the cells. Also mediates lithium-dependent HCO3(-) cotransport. May be regulated by osmolarity.
  • Tissue specificity
    Expressed in the pyramidal cells of the hippocampus (at protein level). Highly expressed in all major regions of the brain, spinal column and in testis, and moderate levels in trachea, thyroid and medulla region of kidney. Low expression levels observed in pancreas and kidney cortex.
  • Sequence similarities
    Belongs to the anion exchanger (TC 2.A.31) family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160512 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160512 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160512.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up