Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIPCRAALTFARCLIRRKIVTLDSLEDTKLCRCLSTMDLIALGVGSTLGA GVYVLAGEVAKADSGPSIVVSFLIAALASVMAGLCYAEFGARVPKTGSAY LYTYVTVGELWAFITGWNLILSYVIGTSSVARAWSGTFDELLSKQIGQFL RTYFRMNYTGLAEYPDFFAVCLILLLAGLLSFGVKESAWVNKVFTAVNIL VLLFVMVAGFVKGNVANWKISEEFLKNISASAREPPSENGTSIYGAGGFM PYGFTGTLAGAATCFYAFVGFDCIATTGEEVRNPQKAIPIGIVTSLLVCF MAYFGVSAALTLMMPYYLLDEKSPLPVAFEYVGWGPAKYVVAAGSLCALS TSLLGSMFPLPRILFAMARDGLLFRFLARVSKRQSPVAATLTAGVISALM AFLFDLKALVDMMSIGTLMAYSLVAACVLILRYQPGLSYDQPKCSPEKDG LGSSPRVTSKSESQVTMLQRQGFSMRTLFCPSLLPTQQSASLVSFLVGFL AFLVLGLSVLTTYGVHAITRLEAWSLALLALFLVLFVAIVLTIWRQPQNQ QKVAFMVPFLPFLPAFSILVNIYLMVQLSADTWVRFSIWMAIGFLIYFSY GIRHSLEGHLRDENNEEDAYPDNVHAAAEEKSAIQANDHHPRNLSSPFIF HEKTSEF
    • Amino acids
      1 to 657
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159526 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATRC2
    • 20.5
    • Amino acid transporter, cationic 2 (low affinity)
    • ATRC 2
    • CAT 2
    • CAT-2
    • CAT2
    • Cat2a
    • Cat2b
    • Cationic amino acid transporter 2A
    • cationic amino acid transporter, y+ system; low affinity cationic amino acid transporter 2
    • CTR2_HUMAN
    • HCAT 2
    • HCAT2
    • Low affinity cationic amino acid transporter 2
    • OTTHUMP00000216432
    • OTTHUMP00000216433
    • OTTMUSP00000041667
    • OTTMUSP00000041669
    • RCAT2
    • SLC7A 2
    • Slc7a2
    • Solute carrier family 7 member 2
    • T cell early activation protein
    • Tea
    see all
  • Function
    Low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). Plays a regulatory role in classical or alternative activation of macrophages.
  • Tissue specificity
    Expressed at high levels in the skeletal muscle, placenta and ovary. Expressed at intermediate levels in the liver and pancreas and at low levels in the kidney and heart.
  • Sequence similarities
    Belongs to the amino acid-polyamine-organocation (APC) superfamily. Cationic amino acid transporter (CAT) (TC 2.A.3.3) family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab159526 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159526 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159526.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up