Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      RYQPGLSYDQPKCSPEKDGLGSSPRVTSKSESQVTMLQRQGFSMRTLFCP SLLPTQQSA
    • Amino acids

      432 to 490
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159527 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as SLC7A2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ATRC2
    • 20.5
    • Amino acid transporter, cationic 2 (low affinity)
    • ATRC 2
    • CAT 2
    • CAT-2
    • CAT2
    • Cat2a
    • Cat2b
    • Cationic amino acid transporter 2A
    • cationic amino acid transporter, y+ system; low affinity cationic amino acid transporter 2
    • CTR2_HUMAN
    • HCAT 2
    • HCAT2
    • Low affinity cationic amino acid transporter 2
    • OTTHUMP00000216432
    • OTTHUMP00000216433
    • OTTMUSP00000041667
    • OTTMUSP00000041669
    • RCAT2
    • SLC7A 2
    • Slc7a2
    • Solute carrier family 7 member 2
    • T cell early activation protein
    • Tea
    see all
  • Function

    Low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). Plays a regulatory role in classical or alternative activation of macrophages.
  • Tissue specificity

    Expressed at high levels in the skeletal muscle, placenta and ovary. Expressed at intermediate levels in the liver and pancreas and at low levels in the kidney and heart.
  • Sequence similarities

    Belongs to the amino acid-polyamine-organocation (APC) superfamily. Cationic amino acid transporter (CAT) (TC 2.A.3.3) family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab159527 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159527 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159527.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up