Overview

  • Product name

    Recombinant Human SLC7A9 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MGDTGLRKRREDEKSIQSQEPKTTSLQKELGLISGISIIVGTIIGSGIFV SPKSVLSNTEAVGPCLIIWAACGVLATLGALCFAELGTMITKSGGEYPYL MEAYGPIPAYLFSWASLIVIKPTSFAIICLSFSEYVCAPFYVGCKPPQIV VKCLAAAAILFISTVNSLSVRLGSYVQNIFTAAKLVIVAIIIISGLVLLA QGNTKNFDNSFEGAQLSVGAISLAFYNGLWAYDGWNQLNYITEELRNPYR NLPLAIIIGIPLVTACYILMNVSYFTVMTATELLQSQAVAVTFGDRVLYP ASWIVPLFVAFSTIGAANGTCFTAGRLIYVAGREGHMLKVLSYISVRRLT PAPAIIFYGIIATIYIIPGDINSLVNYFSFAAWLFYGLTILGLIVMRFTR KELERPIKVPVVIPVLMTLISVFLVLAPIISKPTWEYLYCVLFILSGLLF YFLFVHYKFGWAQKISKPITMHLQMLMEVVPPEEDPE
    • Amino acids

      1 to 487
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161312 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • B(0+) type amino acid transporter 1
    • BAT1
    • CSNU3
    • Glycoprotein associated amino acid transporter b0+AT1
    • Solute carrier family 7 (cationic amino acid transporter y+ system) member 9
    see all
  • Relevance

    SLC7A9 belongs to the amino acid-polyamine-organocation (APC) superfamily. It is a disulfide linked heterodimer with the amino acid transport protein SLC3A1. SLC7A9 is involved in the high affinity, sodium independent transport of cystine and neutral and dibasic amino acids (system b(0,+)-like activity). Thought to be responsible for the high affinity reabsorption of cystine in the kidney tubule. Defects in SLC7A9 are a cause of non type I cystinuria (CSNU). CSNU arises from impaired transport of cystine and dibasic amino acids through the epithelial cells of the renal tubule and gastrointestinal tract. Three types of cystinuria have been described: type I (fully recessive or silent); type II (high excretor); type III (moderate excretor). Defects in SLC7A9 are associated with type II and type III cystinuria. They also might account for some non classic type I cystinuria cases.
  • Cellular localization

    Membrane; multi pass membrane protein (probable)

Images

  • ab161312 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161312 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161312.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up