Overview

  • Product name

    Recombinant Human SLD5 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMTEEVDFLGQDSDGGSEEVVLTPAELIERL EQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKREDLKVSIHQM EMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFA REFMANTESYLKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQE NILVEPDTDEQRDYVIDLEKGSQHLIRYKTIAPLVASGAVQLI
    • Molecular weight

      28 kDa including tags
    • Amino acids

      1 to 223

Specifications

Our Abpromise guarantee covers the use of ab136703 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab136703 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names

    • DNA replication complex GINS protein SLD5
    • GINS complex subunit 4
    • GINS complex subunit 4 (Sld5 homolog)
    • GINS4
    • SLD5
    • SLD5 homolog
    • SLD5 S cerevisiae homolog of
    • SLD5_HUMAN
    see all
  • Function

    The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS4 is important for GINS complex assembly. GINS complex seems to bind preferentially to single-stranded DNA.
  • Sequence similarities

    Belongs to the GINS4/SLD5 family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab136703.

References

ab136703 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab136703.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up