Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      PKSLLLKNSHCDKNPPSTEVVIKEESSPKKDMKPAKDLRLLFSNESEKPT TNSYLMQHQESIIQLQKAGLVRKHTKELERLKSVPADPAPPSRDGPAS
    • Amino acids

      752 to 849
    • Tags

      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab153372 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Slingshot homolog 1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AW551225
    • Coro1c
    • coronin, actin binding protein 1C
    • Gm1394
    • Gm1395
    • hSSH-1L
    • mSSH 1L
    • OTTMUSP00000031415
    • Protein phosphatase Slingshot homolog 1
    • Slingshot 1
    • slingshot 1L
    • slingshot homolog 1
    • slingshot like 1
    • Slingshot1
    • SSH 1
    • SSH 1L
    • SSH-1L
    • SSH-like protein 1
    • Ssh1
    • SSH1_HUMAN
    see all
  • Function

    Protein phosphatase which regulates actin filament dynamics. Dephosphorylates and activates the actin binding/depolymerizing factor cofilin, which subsequently binds to actin filaments and stimulates their disassembly. Inhibitory phosphorylation of cofilin is mediated by LIMK1, which may also be dephosphorylated and inactivated by this protein.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family.
    Contains 1 tyrosine-protein phosphatase domain.
  • Post-translational
    modifications

    Phosphorylated. Inhibitory phosphorylation by PAK4 promotes binding to YWHAZ. Phosphorylation at Ser-978 is decreased by stimuli which promote actin reorganization and lamellipodia formation. Can be dephosphorylated and activated by PPP3CA/calcineurin A. Phosphorylation decreases immediately prior to telophase.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cell projection > lamellipodium. Cleavage furrow. Midbody. Also recruited to actin rich membrane protrusions such as lamellipodia, which may allow local control of actin dynamics at sites of cell locomotion. Also localized to the cleavage furrow and the midbody during cytokinesis.
  • Information by UniProt

Images

  • ab153372 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153372 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153372.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up