Overview

  • Product name
    Recombinant Human SLM-1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEEEKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGKKEDEEKKYL DVISNKNIKLSERVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMS ILGKGSMRDKAKEEELRKSGEAKYAHLSDELHVLIEVFAPPGEAYSRMSH ALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRGRGIRIAPT APSRGRGGAIPPPPPPGRGVLTPRGSTVTRGALPVPPVARGVPTPRARGA PTVPGYRAPPPPAHEAYEEYGYDDGYGGEYDDQTYETYDNSYATQTQSVP EYYDYGHGVSEDAYDSYAPEEWATTSSSLKAPPQRSARGGYREHPYGRY
    • Amino acids
      1 to 349
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165896 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as KHDRBS2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KH domain containing, RNA binding, signal transduction associated protein 2
    • 6330586C16Rik
    • bA535F17.1
    • FLJ38664
    • hSLM 1
    • hSLM-1
    • KH domain containing, RNA binding, signal transduction associated 2
    • KH domain-containing
    • KHDR2_HUMAN
    • khdrbs2
    • MGC26664
    • RNA-binding
    • Sam68 like mammalian protein 1
    • Sam68-like mammalian protein 1
    • signal transduction-associated protein 2
    • SLM 1
    • SLM-1
    • SLM1
    see all
  • Function
    RNA-binding protein that plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. Its phosphorylation by FYN inhibits its ability to regulate splice site selection. Induces an increased concentration-dependent incorporation of exon in CD44 pre-mRNA by direct binding to purine-rich exonic enhancer. May function as an adapter protein for Src kinases during mitosis. Binds both poly(A) and poly(U) homopolymers. Phosphorylation by PTK6 inhibits its RNA-binding ability.
  • Tissue specificity
    Highly expressed in brain, lung, kidney and small intestine. Weakly expressed in placenta, liver, spleen, thymus, ovary and colon.
  • Sequence similarities
    Belongs to the KHDRBS family.
    Contains 1 KH domain.
  • Post-translational
    modifications
    Methylated.
    Tyrosine phosphorylated by FYN, PTK6 and SRC. Tyrosine phosphorylated by SRC during mitosis.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab165896 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165896 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165896.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up