Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLT ENDIQKFPKLRVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETESHEE DNGGWSSFEEDDYESPNDDQDGEDDGDYESPNEEEEAPVEDDADYEPPPS NDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPP PAGRNHSPLPPPQTNHEEPSRSRNHKTAKLPAPSIDRSTKPPLDRSLAPF DREPFTLGKKPPFSDKPSIPAGRSLGEHLPKIQKPPLPPTTERHERSSPL PGKKPPVPKHGWGPDRRENDEDDVHQRPLPQPALLPMSSNTFPSRSTKPS PMNPLPSSHMPGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPL PLPNKPRPPSPAEEENSLNEEWYVSYITRPEAEAALRKINQDGTFLVRDS SKKTTTNPYVLMVLYKDKVYNIQIRYQKESQVYLLGTGLRGKEDFLSVSD IIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGYP
    • Molecular weight

      87 kDa including tags
    • Amino acids

      1 to 533

Specifications

Our Abpromise guarantee covers the use of ab152497 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 76 kDa tyrosine phosphoprotein
    • CG8697
    • LCP 2
    • LCP2
    • LCP2_HUMAN
    • Lymphocyte cytosolic protein 2
    • SH2 domain containing leukocyte protein 76 KD
    • SH2 domain containing leukocyte protein of 76kD
    • SH2 domain containing leukocyte protein of 76kDa
    • SH2 domain-containing leukocyte protein of 76 kDa
    • SLP 76
    • SLP 76 tyrosine phosphoprotein
    • SLP-76
    • SLP-76 tyrosine phosphoprotein
    • SLP76
    • SLP76 tyrosine phosphoprotein
    see all
  • Function

    Involved in T-cell antigen receptor mediated signaling.
  • Tissue specificity

    Highly expressed in spleen, thymus and peripheral blood leukocytes. Highly expressed also in T-cell and monocytic cell lines, expressed at lower level in B-cell lines. Not detected in fibroblast or neuroblastoma cell lines.
  • Sequence similarities

    Contains 1 SAM (sterile alpha motif) domain.
    Contains 1 SH2 domain.
  • Domain

    The SH2 domain mediates interaction with SHB.
  • Post-translational
    modifications

    Phosphorylated after T-cell receptor activation by ZAP-70.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152497 stained with Coomassie Blue.

References

ab152497 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152497.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up