Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ADPMALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFL NLTENDIQKFPKLRVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETES HEEDNGGWSSFEEDDYESPNDDQDGEDDGDYESPNEEEEAPVEDDADYEP PPSNDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAAL PPPPAGRNHSPLPPPQTNHEEPSRSRNHKTAKLPAPSIDRSTKPPLDRSL APFDREPFTLGKKPPFSDKPSIPAGRSLGEHLPKIQKPPLPPTTERHERS SPLPGKKPPVPKHGWGPDRRENDEDDVHQRPLPQPALLPMSSNTFPSRST KPSPMNPLPSSHMPGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRN FPLPLPNKPRPPSPAEEENSLNEEWYVSYITRPEAEAALRKINQDGTFLV RDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKESQVYLLGTGLRGKEDFLS VSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGYPHHHHHH
    • Molecular weight

      61 kDa including tags
    • Amino acids

      1 to 533
    • Tags

      His tag C-Terminus
    • Additional sequence information

      (NP_005556).

Specifications

Our Abpromise guarantee covers the use of ab227404 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 90 % SDS-PAGE.
    ab227404 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: PBS, 10% Glycerol

General Info

  • Alternative names

    • 76 kDa tyrosine phosphoprotein
    • CG8697
    • LCP 2
    • LCP2
    • LCP2_HUMAN
    • Lymphocyte cytosolic protein 2
    • SH2 domain containing leukocyte protein 76 KD
    • SH2 domain containing leukocyte protein of 76kD
    • SH2 domain containing leukocyte protein of 76kDa
    • SH2 domain-containing leukocyte protein of 76 kDa
    • SLP 76
    • SLP 76 tyrosine phosphoprotein
    • SLP-76
    • SLP-76 tyrosine phosphoprotein
    • SLP76
    • SLP76 tyrosine phosphoprotein
    see all
  • Function

    Involved in T-cell antigen receptor mediated signaling.
  • Tissue specificity

    Highly expressed in spleen, thymus and peripheral blood leukocytes. Highly expressed also in T-cell and monocytic cell lines, expressed at lower level in B-cell lines. Not detected in fibroblast or neuroblastoma cell lines.
  • Sequence similarities

    Contains 1 SAM (sterile alpha motif) domain.
    Contains 1 SH2 domain.
  • Domain

    The SH2 domain mediates interaction with SHB.
  • Post-translational
    modifications

    Phosphorylated after T-cell receptor activation by ZAP-70.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab227404.

    MW: 70-100 kDa (SDS-PAGE under reducing conditions).

References

ab227404 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab227404.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up