Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMPRSFLVKKHFNASKKPNYSELDTHTV IISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLS GYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEK FQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMH IRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSN LRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH
    • Molecular weight

      32 kDa including tags
    • Amino acids

      1 to 268
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_003059

Specifications

Our Abpromise guarantee covers the use of ab201878 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 80 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • MGC10182
    • Neural crest transcription factor Slug
    • Protein snail homolog 2
    • Slug (chicken homolog) zinc finger protein
    • Slug homolog zinc finger protein
    • Slug zinc finger protein
    • SLUGH
    • SLUGH 1
    • SLUGH1
    • SNAI 2
    • Snai2
    • SNAI2_HUMAN
    • Snail 2
    • Snail homolog 2
    • Snail2
    • WS 2D
    • WS2D
    • Zinc finger protein SLUG
    • Zinc finger protein SNAI2
    see all
  • Function

    Transcriptional repressor. Involved in the generation and migration of neural crest cells.
  • Tissue specificity

    Expressed in placenta and adult heart, pancreas, liver, kidney and skeletal muscle.
  • Involvement in disease

    Defects in SNAI2 are the cause of Waardenburg syndrome type 2D (WS2D) [MIM:608890]. WS2 is a genetically heterogeneous, autosomal dominant disorder characterized by sensorineural deafness, pigmentary disturbances, and absence of dystopia canthorum. The frequency of deafness is higher in WS2 than in WS1.
  • Sequence similarities

    Belongs to the snail C2H2-type zinc-finger protein family.
    Contains 5 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 15% SDS Page analysis of ab201878 (3µg).

References

ab201878 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201878.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up