Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCS SSCVATDPDSIGAAHLIFCCFRDLCNSE
    • Amino acids
      25 to 102
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163505 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Anti neoplastic urinary protein
    • ANUP
    • ARS
    • ARS component B
    • ARS(component B) 81/S
    • ArsB
    • LY6LS
    • Lymphocyte antigen 6 like secreted
    • MDM
    • Results in cobblestone changes in the skin of the palm
    • Secreted Ly 6/uPAR related protein 1
    • Secreted LY6/PLAUR domain containing 1
    • Secreted Ly6/uPAR related protein 1
    • SLURP 1
    see all
  • Relevance
    SLURP1 (Secreted LY6/PLAUR domain containing 1) belongs to the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. SLURP1 potentiates alpha-7 nicotinic acetylcholine receptors (CHRNA7) in keratinocytes and is implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin. It is a marker of late differentiation of the skin and has an antitumor activity. Mutations in the SLURP1 gene are the cause of Mal de Meleda (MDM), a rare autosomal recessive genetic disease, characterized by inflammatory palmoplantar keratoderma.
  • Cellular localization
    Secreted

Images

  • ab163505 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163505 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163505.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up