Description

  • Product name

    Recombinant Human Smac / Diablo protein (His tag)
    See all Smac / Diablo proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTK AVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLET TWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAE TKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
    • Predicted molecular weight

      22 kDa including tags
    • Amino acids

      56 to 239
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The transit peptide is not included. (Accession # NP_063940)

Specifications

Our Abpromise guarantee covers the use of ab219716 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.48% HEPES, 0.87% Sodium chloride

    ab219716 was lyophilized from 0.22 µm filtered solution.
    Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • 0610041G12Rik
    • DBLOH_HUMAN
    • DBOH
    • DFNA64
    • diablo
    • Diablo homolog
    • Diablo homolog (Drosophila)
    • Diablo homolog mitochondrial
    • Diablo IAP binding mitochondrial protein
    • Diablo like protein
    • DIABLO S
    • Direct IAP binding protein with low pI
    • Direct IAP-binding protein with low pI
    • FLJ10537
    • FLJ25049
    • mitochondrial
    • Mitochondrial Smac protein
    • Second mitochondria derived activator of caspase
    • Second mitochondria-derived activator of caspase
    • Smac
    • SMAC 3
    • Smac protein
    • SMAC3
    see all
  • Function

    Promotes apoptosis by activating caspases in the cytochrome c/Apaf-1/caspase-9 pathway. Acts by opposing the inhibitory activity of inhibitor of apoptosis proteins (IAP).
  • Tissue specificity

    Ubiquitously expressed with highest expression in testis. Expression is also high in heart, liver, kidney, spleen, prostate and ovary. Low in brain, lung, thymus and peripheral blood leukocytes.
  • Domain

    The mature N-terminus mediates interaction with XIAP.
  • Cellular localization

    Mitochondrion. Released into the cytosol when cells undergo apoptosis.
  • Information by UniProt

Images

  • SDS-PAGE analysis of DTT-reduced ab219716 stained overnight with Coomassie Blue.

     

References

ab219716 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219716.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up