Description

  • Product name

    Recombinant Human SMAD6 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSV AYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTR
    • Amino acids

      285 to 384
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158843 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • hSMAD6
    • MAD homolog 6
    • MADH6
    • MADH7
    • Mothers against decapentaplegic homolog 6
    • Mothers against DPP homolog 6
    • SMAD 6
    • SMAD family member 6
    • SMAD mothers against DPP homolog 6
    • Smad6
    • SMAD6_HUMAN
    see all
  • Function

    Antagonist of signaling by TGF-beta (transforming growth factor) type 1 receptor superfamily members; has been shown to inhibit selectively BMP (bone morphogenetic proteins) signaling by competing with the co-SMAD SMAD4 for receptor-activated SMAD1. SMAD6 is an inhibitory SMAD (I-SMAD) or antagonistic SMAD. Binds to regulatory elements in target promoter regions.
  • Tissue specificity

    Ubiquitous in various organs, with higher levels in lung. Isoform B is up-regulated in diseased heart tissue.
  • Sequence similarities

    Belongs to the dwarfin/SMAD family.
    Contains 1 MH1 (MAD homology 1) domain.
    Contains 1 MH2 (MAD homology 2) domain.
  • Post-translational
    modifications

    Phosphorylated by BMP type 1 receptor kinase and by PRKX.
    Ubiquitinated by WWP1.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab158843 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158843 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158843.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up