Overview

  • Product name

    Recombinant Human SMAD9 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MHSTTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKG AMDELERALSCPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPD LQSHHELKPLECCEFPFGSKQKEVCINPYHYRRVETPVLPPVLVPRHSEY NPQLSLLAKFRSASLHSEPLMPHNATYPDSFQQPPCSALPPSPSHAFSQS PCTASYPHSPGSPSEPESPYQHSVDTPPLPYHATEASETQSGQPVDATAD RHVVLSIPNGDFRPVCYEEPQHWCSVAYYELNNRVGETFQASSRSVLIDG FTDPSNNRNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECV SDSSIFVQSRNCNYQHGFHPATVCKIPSGCSLKVFNNQLFAQLLAQSVHH GFEVVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLD KVLTQMGSPHNPISSVS
    • Molecular weight

      86 kDa including tags
    • Amino acids

      1 to 467

Specifications

Our Abpromise guarantee covers the use of ab140808 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Purity

    > 70 % Densitometry.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.003% EDTA, 0.29% Sodium chloride

General Info

  • Alternative names

    • MAD homolog 9
    • Madh6
    • Mothers against decapentaplegic
    • Mothers against decapentaplegic homolog 9
    • Mothers against DPP homolog 9
    • SMAD 9
    • SMAD family member 9
    • SMAD, mothers against DPP homolog 9 (Drosophila)
    • SMAD8A
    • SMAD8B
    • Smad9
    • SMAD9_HUMAN
    see all
  • Function

    Transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase. SMAD9 is a receptor-regulated SMAD (R-SMAD).
  • Tissue specificity

    Expressed in heart, brain, placenta, lung, skeletal muscle, prostate, testis, ovary and small intestine. Also expressed in fetal brain, lung and kidney.
  • Involvement in disease

    Pulmonary hypertension, primary, 2
  • Sequence similarities

    Belongs to the dwarfin/SMAD family.
    Contains 1 MH1 (MAD homology 1) domain.
    Contains 1 MH2 (MAD homology 2) domain.
  • Post-translational
    modifications

    Phosphorylated on serine by BMP (bone morphogenetic proteins) type 1 receptor kinase.
  • Cellular localization

    Cytoplasm. Nucleus. In the cytoplasm in the absence of ligand. Migration to the nucleus when complexed with SMAD4.
  • Information by UniProt

Images

  • SDS PAGE analysis of ab140808 at ~82 kDa.

References

ab140808 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140808.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up