Description

  • Product name

    Recombinant Human SMARCA2 / BRM protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SYYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILAD EMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSV VKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMI VDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLL PTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRR LKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGK GGAKTLMNTIMQLRKICNHPYMFQHIEESFAEHLGYSNGVINGAELYRAS GKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGT TKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWN PHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVI QAGMFDQKSSSHERRAF
    • Predicted molecular weight

      76 kDa including tags
    • Amino acids

      700 to 1216
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-SUMO-tag.

Specifications

Our Abpromise guarantee covers the use of ab236192 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • ATP dependent helicase SMARCA2
    • ATP-dependent helicase SMARCA2
    • BAF190
    • BAF190B
    • BRG1-associated factor 190B
    • BRM
    • FLJ36757
    • Global transcription activator homologous sequence
    • hBRM
    • hSNF2a
    • MGC74511
    • Possible global transcription activator SNF2L2
    • Probable global transcription activator SNF2L2
    • Protein brahma homolog
    • SMARCA2
    • SMCA2_HUMAN
    • SNF2 alpha
    • SNF2 like 2
    • SNF2-alpha
    • SNF2/SWI2 like protein 2
    • SNF2L2
    • SNF2LA
    • Sth1p
    • Sucrose nonfermenting 2 like protein 2
    • SWI/SNF related matrix associated actin dependent regulator of chromatin subfamily A member 2
    • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2
    see all
  • Function

    Transcriptional coactivator cooperating with nuclear hormone receptors to potentiate transcriptional activation. Also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.
  • Involvement in disease

    Nicolaides-Baraitser syndrome
  • Sequence similarities

    Belongs to the SNF2/RAD54 helicase family.
    Contains 1 bromo domain.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
    Contains 1 HSA domain.
    Contains 1 QLQ domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab236192.

References

ab236192 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236192.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up