Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      FTWEQAFLRWLPSLSPDCINVVVTGKDRLTAGLINIVSFDLLSKLEKQLK TPFKVVIIDESHFLKNSRTARCRAAMPVLKVAKRVILLSGTPAMSRPAEL YTQIIAVKP
    • Amino acids

      491 to 599
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162337 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HARP
    • HepA Related Protein
    • HepA-related protein
    • hHARP
    • SIOD
    • SMAL1_HUMAN
    • SMARCA like Protein 1
    • smarcal1
    • Sucrose nonfermenting protein 2 like 1
    • Sucrose nonfermenting protein 2-like 1
    • SWI/SNF Related
    • SWI/SNF related matrix associated actin dependent regulator of chromatin subfamily A like protein 1
    • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1
    see all
  • Function

    ATP-dependent annealing helicase that catalyzes the rewinding of the stably unwound DNA. Rewinds single-stranded DNA bubbles that are stably bound by replication protein A (RPA). Acts throughout the genome to reanneal stably unwound DNA, performing the opposite reaction of many enzymes, such as helicases and polymerases, that unwind DNA.
  • Tissue specificity

    Ubiquitously expressed, with high levels in testis.
  • Involvement in disease

    Defects in SMARCAL1 are a cause of Schimke immuno-osseous dysplasia (SIOD) [MIM:242900]. SIOD causes spondyloepiphyseal dysplasia, renal dysfunction and T-cell immunodeficiency. Approximately half of all patients also exhibit hyperthyroidism, while around half also exhibit episodal cerebral ischema.
  • Sequence similarities

    Belongs to the SNF2/RAD54 helicase family. SMARCAL1 subfamily.
    Contains 2 HARP domains.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab162337 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162337 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162337.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up