Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      ESRKKSGKKGQASLYGKRRSQKEEDEQEDLTKDMEDPTPVPNIEEVVLPK NVNLKKDSENTPVKGGTVADLDEQDEETVTAGGKEDEDPAKGDQSRSVDL
    • Amino acids

      338 to 437
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152694 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as SMARCC1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AI115498
    • BAF 155
    • BAF155
    • BRG 1 associated factor 155
    • BRG1 associated factor 155
    • BRG1-associated factor 155
    • Chromatin remodeling complex BAF155 subunit
    • CRACC 1
    • CRACC1
    • Mammalian chromatin remodeling complex BRG 1 associated factor 155
    • Mammalian chromatin remodeling complex BRG1 associated factor 155
    • Rsc 8
    • Rsc8
    • SMARC C1
    • SMARCC 1
    • SMARCC1
    • SMRC1_HUMAN
    • SRG 3
    • SRG3
    • SWI 3
    • SWI/SNF complex 155 kDa subunit
    • SWI/SNF complex subunit SMARCC1
    • SWI/SNF related matrix associated actin dependent regulator of chromatin c1
    • SWI/SNF related matrix associated actin dependent regulator of chromatin subfamily c member 1
    • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1
    • SWI3
    see all
  • Function

    Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). May stimulate the ATPase activity of the catalytic subunit of the complex. Also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.
  • Tissue specificity

    Expressed in brain, heart, muscle, placenta, lung, liver, muscle, kidney and pancreas.
  • Sequence similarities

    Belongs to the SMARCC family.
    Contains 1 SANT domain.
    Contains 1 SWIRM domain.
  • Post-translational
    modifications

    Phosphorylated on undefined residues at the G2/M transition by ERK1 and other kinases. This may contribute to cell cycle specific inactivation of remodeling complexes containing the phosphorylated protein.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab152694 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152694 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152694.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up