Overview

  • Product name

    Recombinant Human SMC1L2 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      KVAKDCIRFLKEERAEPETFLALDYLDIKPINERLRELKGCKMVIDVIKT QFPQLKKVIQFVCGNGLVCETMEEARHIALSGPERQKTVALDGTLFLKSG VISGGSSDLK
    • Amino acids

      551 to 660
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162088 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • bK268H5
    • SMC protein 1B
    • SMC-1-beta
    • SMC-1B
    • SMC1 beta
    • SMC1B
    • SMC1B_HUMAN
    • SMC1beta
    • SMC1beta protein
    • Smc1l2
    • Structural maintenance of chromosomes 1-like 2
    • Structural maintenance of chromosomes 1B
    • Structural maintenance of chromosomes protein 1B
    see all
  • Function

    Meiosis-specific component of cohesin complex. Required for the maintenance of meiotic cohesion, but not, or only to a minor extent, for its establishment. Contributes to axial element (AE) formation and the organization of chromatin loops along the AE. Plays a key role in synapsis, recombination and chromosome movements. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The meiosis-specific cohesin complex probably replaces mitosis specific cohesin complex when it dissociates from chromatin during prophase I.
  • Sequence similarities

    Belongs to the SMC family. SMC1 subfamily.
  • Domain

    The flexible hinge domain, which separates the large intramolecular coiled coil regions, allows the heterotypic interaction with the corresponding domain of SMC3, forming a V-shaped heterodimer. The two heads of the heterodimer are then connected by different ends of the cleavable RAD21 or REC8 protein, forming a ring structure.
  • Cellular localization

    Nucleus. Chromosome. Chromosome > centromere. Associates with chromatin. In prophase I stage of meiosis, localizes along the AE of synaptonemal complexes. In late-pachytene-diplotene, the bulk of protein dissociates from the chromosome arms probably because of phosphorylation by PLK, except at centromeres, where cohesin complexes remain. Remains chromatin associated at the centromeres up to metaphase II. At anaphase II, dissociates from centromeres, allowing chromosomes segregation.
  • Information by UniProt

Images

  • ab162088 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162088 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162088.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up