Description

  • Product name

    Recombinant Human SMC6 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAKRKEENFSSPKNAKRPRQEELEDFDKDGDEDECKGTTLTAAEVGIIES IHLKNFMCHSMLGPFKFGSNVNFVVGNNGSGKSAVLTALIVGLGGRAVAT NRGSSLKGFV
    • Amino acids

      1 to 110
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164073 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as SMC6L1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ22116
    • FLJ35534
    • hSMC6
    • SMC 6
    • SMC protein 6
    • SMC-6
    • SMC6
    • SMC6 protein
    • SMC6 structural maintenance of chromosomes 6 like 1
    • SMC6_HUMAN
    • Smc6l1
    • Structural maintenance of chromosomes 6
    • Structural maintenance of chromosomes 6 like 1
    • Structural maintenance of chromosomes protein 6
    see all
  • Function

    Core component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs). Required for recruitment of telomeres to PML nuclear bodies.
  • Tissue specificity

    Widely expressed. Overexpressed in testis.
  • Sequence similarities

    Belongs to the SMC family. SMC6 subfamily.
  • Domain

    The flexible hinge domain, which separates the large intramolecular coiled coil regions, allows the heterotypic interaction with the corresponding domain of SMC5, forming a V-shaped heterodimer.
  • Post-translational
    modifications

    Sumoylated by NSMCE2/MMS21.
    Ubiquitinated.
  • Cellular localization

    Nucleus. Chromosome. Chromosome > telomere. Associates with chromatin. Localizes to PML nuclear bodies in ALT cell lines.
  • Information by UniProt

Images

  • ab164073 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164073 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164073.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up