Recombinant Human SMOC1 protein (ab163774)

Description

  • Product name

    Recombinant Human SMOC1 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SVQNKTPVCSGSVTDKPLSQGNSGRKDDGSKPTPTMETQPVFDGDEITAP TLWIKHLVIKDSKLNNTNIRNS
    • Amino acids

      150 to 221
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163774 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Secreted modular calcium-binding protein 1
    • SMOC-1
    • SMOC1
    • SMOC1_HUMAN
    • SPARC-related modular calcium-binding protein 1
    see all
  • Function

    Plays essential roles in both eye and limb development. Probale regulator of osteoblast differentiation.
  • Tissue specificity

    Widely expressed in many tissues with a strongest signal in ovary. No expression in spleen.
  • Involvement in disease

    Defects in SMOC1 are the cause of ophthalmoacromelic syndrome (OAS) [MIM:206920]. A rare disorder presenting with anophthalmia or microphthalmia and limb anomalies. Limb malformations include fused 4th and 5th metacarpals and short 5th finger in hands, and olygodactyly in foot (four toes). Most patients have bilateral anophthalmia/ microphthalmia, but unilateral abnormality is also noted. Other malformations are rare, but venous or vertebral anomaly was recognized each in single cases.
  • Sequence similarities

    Contains 2 EF-hand domains.
    Contains 1 Kazal-like domain.
    Contains 2 thyroglobulin type-1 domains.
  • Post-translational
    modifications

    Glycosylated.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix > basement membrane. In or around the basement membrane.
  • Information by UniProt

Images

  • ab163774 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163774 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163774.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up