Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGPLTSFRRAPSSSPAKASSAISLAPSSVGSFLVRSPVPVAPVTSSENSA GDRHESGMLGLPETTGT
    • Molecular weight

      33 kDa including tags
    • Amino acids

      1 to 67

Specifications

Our Abpromise guarantee covers the use of ab131778 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ35168
    • FLJ35365
    • FLJ35620
    • FLJ38597
    • Smoothelin
    • SMSMO
    • Smtn
    • SMTN_HUMAN
    see all
  • Function

    Structural protein of the cytoskeleton.
  • Tissue specificity

    Smooth muscle; contractile or vascular (for the long form).
  • Sequence similarities

    Belongs to the smoothelin family.
    Contains 1 CH (calponin-homology) domain.
  • Cellular localization

    Cytoplasm > cytoskeleton. Exhibits a filamentous organization.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131778 stained with Coomassie Blue.

References

ab131778 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131778.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up