Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQN FLLESNLGKKKYETEFHPGTTSFGMSVFNLSNAIVGSGILGLSYAMANTG IALFIILLTFVSIFSLYSVHLLLKTANEGGSLLYEQLGYKAFGLVGKLAA SGSITMQNIGAMSSYLFIVKYELPLVIQALTNIEDKTGLWYLNGNYLVLL VSLVVILPLSLFRNLGYLGYTSGLSLLCMVFFLIVVICKKFQVPCPVEAA LIINETINTTLTQPTALVPALSHNVTENDSCRPHYFIFNSQTVYAVPILI FSFVCHPAVLPIYEELKDRSRRRMMNVSKISFFAMFLMYLLAALFGYLTF YEHVESELLHTYSSILGTDILLLIVRLAVLMAVTLTVPVVIFPIRSSVTH LLCASKDFSWWRHSLITVSILAFTNLLVIFVPTIRDIFGFIGASAASMLI FILPSAFYIKLVKKEPMKSVQKIGALFFLLSGVLVMTGSMALIVLDWVHN APGGGH
    • Amino acids

      1 to 506
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153368 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as SLC38A2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Amino acid transporter 2
    • Amino acid transporter A2
    • ATA2
    • KIAA1382
    • PRO1068
    • Protein 40-9-1
    • S38A2_HUMAN
    • SAT2
    • Slc38a2
    • SNAT2
    • Sodium-coupled neutral amino acid transporter 2
    • Solute carrier family 38 member 2
    • System A amino acid transporter
    • System A amino acid transporter 2
    • System A transporter 1
    • System N amino acid transporter 2
    see all
  • Function

    Functions as a sodium-dependent amino acid transporter. Mediates the saturable, pH-sensitive and electrogenic cotransport of neutral amino acids and sodium ions with a stoichiometry of 1:1. May function in the transport of amino acids at the blood-brain barrier and in the supply of maternal nutrients to the fetus through the placenta.
  • Tissue specificity

    Ubiquitously expressed. Widely expressed in the central nervous system with higher concentrations in caudal regions. Expressed by glutamatergic and GABAergic neurons together with astrocytes and other non-neuronal cells in the cerebral cortex (at protein level).
  • Sequence similarities

    Belongs to the amino acid/polyamine transporter 2 family.
  • Post-translational
    modifications

    Polyubiquitination by NEDD4L regulates the degradation and the activity of SLC38A2.
  • Cellular localization

    Cell membrane. Insulin promotes recruitment to the plasma membrane from a pool localized in the trans-Golgi network or endosomes (By similarity). Enriched in the somatodendritic compartment of neurons, it is also detected at the axonal shaft but excluded from the nerve terminal.
  • Information by UniProt

Images

  • ab153368 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153368 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153368.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up