Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      SQLHGSTKYIIDPQNGLSFSSVKVQEKSTWKMCISSTGNAGQVPAVGGIK FFSDHMADTTTELERIKSKNLKNNVLQLPLCEKTISVNIQRNPKEGLLCA SSPASCCHVI
    • Amino acids

      656 to 765
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153387 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZp779A1866
    • FLJ20224
    • HSNFRK
    • KIAA0096
    • SNF related kinase
    • SNF related serine/threonine protein kinase
    • SNF-related serine/threonine-protein kinase
    • SNF1 related kinase
    • SNF1-related kinase
    • SNFRK
    • Snrk
    • SNRK_HUMAN
    see all
  • Function

    May play a role in hematopoietic cell proliferation or differentiation. Potential mediator of neuronal apoptosis.
  • Tissue specificity

    Expressed in hematopoietic progenitor cells and leukemic cell lines. Weakly expressed in the testis.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
    Contains 1 UBA domain.
  • Post-translational
    modifications

    Autophosphorylated.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab153387 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153387 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153387.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up