Description

  • Product name

    Recombinant human SNRK protein (Active)
    See all SNRK proteins and peptides
  • Biological activity

    Specific activity is 16 nmol/min/mg.

  • Purity

    > 80 % Densitometry.
    Purity was determined to be >80% by densitometry.
  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAGFKRGYDGKIAGLYDLDKTLGRGHFAVVKLARHVFTGEKVAVKVIDKT KLDTLATGHLFQEVRCMKLVQHPNIVRLYEVIDTQTKLYLILELGDGGDM FDYIMKHEEGLNEDLAKKYFAQIVHAISYCHKLHVVHRDLKPENVVFFEK QGLVKLTDFGFSNKFQPGKKLTTSCGSLAYSAPEILLGDEYDAPAVDIWS LGVILFMLVCGQPPFQEANDSETLTMIMDCKYTVPSHVSKECKDLITRML QRDPKRRASLEEIENHPWLQGVDPSPATKYNIPLVSYKNLSEEEHNSIIQ RMVLGDIADRDAIVEALETNRYNHITATYFLLAERILREKQEKEIQTRSA SPSNIKAQFRQSWPTKIDVPQDLEDDLTATPLSHATVPQSPARAADSVLN GHRSKGLCDSAKKDDLPELAGPALSTVPPASLKPTASGRKCLFRVEEDEE EDEEDKKPMSLSTQVVLRRKPSVTNRLTSRKSAPVLNQIFEEGESDDEFD MDENLPPKLSRLKMNIASPGTVHKRYHRRKSQGRGSSCSSSETSDDDSES RRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSNASGGVDKASPSE NNAGGGSPSSGSGGNPTNTSGTTRRCAGPSNSMQLASRSAGELVESLKLM SLCLGSQLHGSTKYIIDPQNGLSFSSVKVQEKSTWKMCISSTGNAGQVPA VGGIKFFSDHMADTTTELERIKSKNLKNNVLQLPLCEKTISVNIQRNPKE GLLCASSPASCCHVI
    • Predicted molecular weight

      110 kDa including tags
    • Amino acids

      1 to 765
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_017719.

Specifications

Our Abpromise guarantee covers the use of ab204151 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.88% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • DKFZp779A1866
    • FLJ20224
    • HSNFRK
    • KIAA0096
    • SNF related kinase
    • SNF related serine/threonine protein kinase
    • SNF-related serine/threonine-protein kinase
    • SNF1 related kinase
    • SNF1-related kinase
    • SNFRK
    • Snrk
    • SNRK_HUMAN
    see all
  • Function

    May play a role in hematopoietic cell proliferation or differentiation. Potential mediator of neuronal apoptosis.
  • Tissue specificity

    Expressed in hematopoietic progenitor cells and leukemic cell lines. Weakly expressed in the testis.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
    Contains 1 UBA domain.
  • Post-translational
    modifications

    Autophosphorylated.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • The specific activity of SNRK (ab204151) was determined to be 14 nmol/min/mg as per activity assay protocol
  • SDS PAGE analysis of ab204151
  • SDS PAGE analysis of ab204151
  • The specific activity of SNRK was determined to be 16 nmol/min/mg.

  • SDS-PAGE analysis of ab204151 which was determined to be >80% pure by densitometry.

References

ab204151 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204151.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up