Recombinant Human SNRNP25 protein (ab107142)

Description

  • Product name

    Recombinant Human SNRNP25 protein
  • Purity

    > 85 % SDS-PAGE.
    ab107142 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMDVFQEGLAMVVQDPLLCDLPIQVTLEEVN SQIALEYGQAMTVRVCKMDGEVMPVVVVQSATVLDLKKAI QRYVQLKQEREGGIQHISWSYVWRTYHLTSAGEKLTEDRKKLRDYGIRNR DEVSFIKKLRQK
    • Predicted molecular weight

      17 kDa including tags
    • Amino acids

      1 to 132
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107142 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0308% DTT, 0.316% Tris HCl, 20% Glycerol, 1.16% Sodium chloride

General Info

  • Alternative names

    • 3300001G02Rik
    • AL033324
    • C16ORF33
    • FLJ22940
    • Minus-99 protein
    • OTTMUSP00000005540
    • OTTMUSP00000034622
    • OTTMUSP00000034623
    • RGD1310922
    • RP23-177M10.3
    • small nuclear ribonucleoprotein 25kDa (U11/U12)
    • SNR25_HUMAN
    • Snrnp25
    • U11/U12 small nuclear ribonucleoprotein 25 kDa protein
    • U11/U12 snRNP 25 kDa protein
    • U11/U12-25K
    • Z69719.2-001
    see all
  • Sequence similarities

    Contains 1 ubiquitin-like domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab107142 (3 µg) at approximately 17.4 kDa.

References

ab107142 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab107142.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up