Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPP RCSSLQAPIMLLSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCD NYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGH TSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVT FNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSLSSEGSYL LSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKI AAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKR LYMGEIQ
    • Amino acids

      1 to 357
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160476 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 38 kDa-splicing factor
    • 40K
    • FLJ41108
    • hPRP8BP
    • MGC1910
    • Prp8-binding protein
    • PRP8BP
    • PRPF8BP
    • RP11-490K7.3
    • small nuclear ribonucleoprotein 40kDa (U5)
    • SNR40_HUMAN
    • Snrnp40
    • SPF38
    • U5 small nuclear ribonucleoprotein 40 kDa protein
    • U5 snRNP 40 kDa protein
    • U5 snRNP-specific 40 kDa protein
    • U5 snRNP-specific 40 kDa protein (hPrp8-binding)
    • U5-40K
    • WD repeat domain 57 (U5 snRNP specific)
    • WD repeat-containing protein 57
    • WDR57
    see all
  • Function

    Component of the U5 small nuclear ribonucleoprotein (snRNP) complex. The U5 snRNP is part of the spliceosome, a multiprotein complex that catalyzes the removal of introns from pre-messenger RNAs.
  • Sequence similarities

    Contains 7 WD repeats.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab160476 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160476 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160476.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up