Description

  • Product name

    Recombinant Human SNRPF protein
  • Purity

    > 95 % SDS-PAGE.
    ab102559 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSLPLNPKPFLNGLTGKPVMVKLKWGMEYK GYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVL YIRGVEEEEEDGEMRE
    • Predicted molecular weight

      12 kDa including tags
    • Amino acids

      1 to 86
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102559 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 0.0292% EDTA, 10% Glycerol

General Info

  • Alternative names

    • PBSCF
    • Sm F
    • Sm protein F
    • Small nuclear ribonucleoprotein F
    • Small nuclear ribonucleoprotein polypeptide F
    • SMF
    • snRNP F
    • snRNPF
    see all
  • Relevance

    SNRPF belongs to the snRNP Sm proteins family and is associated with snRNP U1, U2, U4/U6 and U5.
  • Cellular localization

    Nuclear

Images

  • 15% SDS-PAGE analysis of ab102559 (3 µg).

References

ab102559 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab102559.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up